PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000844682
Common NameNAC7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 64aa    MW: 7221.39 Da    PI: 6.2317
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000844682genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM51.24.3e-161662148
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                   +p+G+rF+Ptdeelv +yL +kv++ +l++ ++i+e+d+++++Pw Lp
  MDP0000844682 16 MPVGYRFRPTDEELVLHYLMRKVHAAPLPA-SIIPEFDVFETHPWGLP 62
                   79****************************.89*************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-18963IPR003441NAC domain
PROSITE profilePS5100520.0111663IPR003441NAC domain
PfamPF023654.8E-81759IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 64 aa     Download sequence    Send to blast
MENIKENYVI NGGVKMPVGY RFRPTDEELV LHYLMRKVHA APLPASIIPE FDVFETHPWG  60
LPG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.79221e-103bud| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008379080.11e-42PREDICTED: NAC transcription factor 25
SwissprotQ9FY939e-22NAC83_ARATH; NAC domain-containing protein 83
TrEMBLD9ZJA62e-42D9ZJA6_MALDO; NAC domain class transcription factor
STRINGPOPTR_0001s33260.13e-24(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14000.11e-24NAC domain containing protein 84